SCOP 1.61: Domain d1jrim_: 1jri M:

Lineage for d1jrim_ (1jri M:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.38: Sm-like fold [50181] (2 superfamilies)

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (2 families)

5. Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (5 proteins)

6. Protein Archaeal homoheptameric Sm protein [63758] (4 species)

7. Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (2 PDB entries)

8. Domain d1jrim_: 1jri M: [67133]

Details for d1jrim_

PDB Entry: 1jri, 2.8 Å

PDB Description: the crystal structure of an sm-like archaeal protein with two heptamers in the asymmetric unit.

SCOP Domain Sequences for d1jrim_:

Sequence; same for both SEQRES and ATOM records:

>d1jrim_ b.38.1.1 (M:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum}
qrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtvli
rgdnivyisrgkla

Timeline for d1jrim_:

• d1jrim_ first appeared in SCOP 1.59
  
• d1jrim_ appears in SCOP 1.63
  
• d1jrim_ appears in the current release, SCOPe 2.08, called d1jrim1