Lineage for d1jrih_ (1jri H:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166075Fold b.38: Sm-like fold [50181] (2 superfamilies)
  4. 166076Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (2 families) (S)
  5. 166077Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (5 proteins)
  6. 166078Protein Archaeal homoheptameric Sm protein [63758] (4 species)
  7. 166124Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (2 PDB entries)
  8. 166139Domain d1jrih_: 1jri H: [67128]

Details for d1jrih_

PDB Entry: 1jri (more details), 2.8 Å

PDB Description: the crystal structure of an sm-like archaeal protein with two heptamers in the asymmetric unit.

SCOP Domain Sequences for d1jrih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrih_ b.38.1.1 (H:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum}
nvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtv
lirgdnivyisrg

SCOP Domain Coordinates for d1jrih_:

Click to download the PDB-style file with coordinates for d1jrih_.
(The format of our PDB-style files is described here.)

Timeline for d1jrih_: