Class a: All alpha proteins [46456] (290 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families) |
Family a.24.15.1: FAD-dependent thiol oxidase [69001] (3 proteins) |
Protein Thiol oxidase Erv2p [69002] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69003] (2 PDB entries) |
Domain d1jraa_: 1jra A: [67117] complexed with fad |
PDB Entry: 1jra (more details), 2 Å
SCOPe Domain Sequences for d1jraa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jraa_ a.24.15.1 (A:) Thiol oxidase Erv2p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ddkvkkevgraswkyfhtllarfpdeptpeereklhtfiglyaelypcgecsyhfvklie kypvqtssrtaaamwgchihnkvneylkkdiydcatiledydcgcs
Timeline for d1jraa_: