Lineage for d1jr8a_ (1jr8 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353428Fold a.24: Four-helical up-and-down bundle [47161] (20 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 353737Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (1 family) (S)
  5. 353738Family a.24.15.1: FAD-dependent thiol oxidase [69001] (2 proteins)
  6. 353745Protein Thiol oxidase Erv2p [69002] (1 species)
  7. 353746Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69003] (2 PDB entries)
  8. 353747Domain d1jr8a_: 1jr8 A: [67115]

Details for d1jr8a_

PDB Entry: 1jr8 (more details), 1.5 Å

PDB Description: Crystal Structure of Erv2p

SCOP Domain Sequences for d1jr8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jr8a_ a.24.15.1 (A:) Thiol oxidase Erv2p {Baker's yeast (Saccharomyces cerevisiae)}
ddkvkkevgraswkyfhtllarfpdeptpeereklhtfiglyaelypcgecsyhfvklie
kypvqtssrtaaamwgchihnkvneylkkdiydcatiledydcgc

SCOP Domain Coordinates for d1jr8a_:

Click to download the PDB-style file with coordinates for d1jr8a_.
(The format of our PDB-style files is described here.)

Timeline for d1jr8a_: