Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.17: Spermidine synthase [69557] (3 proteins) contains additional N-terminal tetramerisation all-beta domain, res. 1-71 |
Protein Spermidine synthase [69558] (6 species) polyamine aminopropyltransferase |
Species Thermotoga maritima [TaxId:2336] [69559] (2 PDB entries) |
Domain d1jq3a_: 1jq3 A: [67079] complexed with aat |
PDB Entry: 1jq3 (more details), 1.8 Å
SCOPe Domain Sequences for d1jq3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jq3a_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} rtlkelerelqprqhlwyfeyytgnnvglfmkmnrviysgqsdiqridifenpdlgvvfa ldgitmttekdefmyhemlahvpmflhpnpkkvliigggdggtlrevlkhdsvekailce vdglvieaarkylkqtscgfddpraeiviangaeyvrkfknefdviiidstdptagqggh lfteefyqacydalkedgvfsaetedpfydigwfklayrriskvfpitrvylgfmttyps gmwsytfaskgidpikdfdpekvrkfnkelkyyneevhvasfalpnfvkkelglm
Timeline for d1jq3a_: