PDB entry 1jq3

View 1jq3 on RCSB PDB site
Description: Crystal Structure of Spermidine Synthase in Complex with Transition State Analogue AdoDATO
Class: transferase
Keywords: aminopropyltransferase, homo-tetramer, thermophyle, transition-state analogue, beta-barrel, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2001-08-03, released 2001-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.196
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spermidine synthase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jq3a_
  • Chain 'B':
    Compound: spermidine synthase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jq3b_
  • Chain 'C':
    Compound: spermidine synthase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jq3c_
  • Chain 'D':
    Compound: spermidine synthase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jq3d_
  • Heterogens: AAT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jq3A (A:)
    mrtlkelerelqprqhlwyfeyytgnnvglfmkmnrviysgqsdiqridifenpdlgvvf
    aldgitmttekdefmyhemlahvpmflhpnpkkvliigggdggtlrevlkhdsvekailc
    evdglvieaarkylkqtscgfddpraeiviangaeyvrkfknefdviiidstdptagqgg
    hlfteefyqacydalkedgvfsaetedpfydigwfklayrriskvfpitrvylgfmttyp
    sgmwsytfaskgidpikdfdpekvrkfnkelkyyneevhvasfalpnfvkkelglm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jq3A (A:)
    rtlkelerelqprqhlwyfeyytgnnvglfmkmnrviysgqsdiqridifenpdlgvvfa
    ldgitmttekdefmyhemlahvpmflhpnpkkvliigggdggtlrevlkhdsvekailce
    vdglvieaarkylkqtscgfddpraeiviangaeyvrkfknefdviiidstdptagqggh
    lfteefyqacydalkedgvfsaetedpfydigwfklayrriskvfpitrvylgfmttyps
    gmwsytfaskgidpikdfdpekvrkfnkelkyyneevhvasfalpnfvkkelglm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jq3B (B:)
    mrtlkelerelqprqhlwyfeyytgnnvglfmkmnrviysgqsdiqridifenpdlgvvf
    aldgitmttekdefmyhemlahvpmflhpnpkkvliigggdggtlrevlkhdsvekailc
    evdglvieaarkylkqtscgfddpraeiviangaeyvrkfknefdviiidstdptagqgg
    hlfteefyqacydalkedgvfsaetedpfydigwfklayrriskvfpitrvylgfmttyp
    sgmwsytfaskgidpikdfdpekvrkfnkelkyyneevhvasfalpnfvkkelglm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jq3B (B:)
    rtlkelerelqprqhlwyfeyytgnnvglfmkmnrviysgqsdiqridifenpdlgvvfa
    ldgitmttekdefmyhemlahvpmflhpnpkkvliigggdggtlrevlkhdsvekailce
    vdglvieaarkylkqtscgfddpraeiviangaeyvrkfknefdviiidshlfteefyqa
    cydalkedgvfsaetedpfydigwfklayrriskvfpitrvylgfmttypsgmwsytfas
    kgidpikdfdpekvrkfnkelkyyneevhvasfalpnfvkkelglm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jq3C (C:)
    mrtlkelerelqprqhlwyfeyytgnnvglfmkmnrviysgqsdiqridifenpdlgvvf
    aldgitmttekdefmyhemlahvpmflhpnpkkvliigggdggtlrevlkhdsvekailc
    evdglvieaarkylkqtscgfddpraeiviangaeyvrkfknefdviiidstdptagqgg
    hlfteefyqacydalkedgvfsaetedpfydigwfklayrriskvfpitrvylgfmttyp
    sgmwsytfaskgidpikdfdpekvrkfnkelkyyneevhvasfalpnfvkkelglm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jq3C (C:)
    lkelerelqprqhlwyfeyytgnnvglfmkmnrviysgqsdiqridifenpdlgvvfald
    gitmttekdefmyhemlahvpmflhpnpkkvliigggdggtlrevlkhdsvekailcevd
    glvieaarkylkqtscgfddpraeiviangaeyvrkfknefdviiidstdptagqgghlf
    teefyqacydalkedgvfsaetedpfydigwfklayrriskvfpitrvylgfmttypsgm
    wsytfaskgidpikdfdpekvrkfnkelkyyneevhvasfalpnfvkkelglm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jq3D (D:)
    mrtlkelerelqprqhlwyfeyytgnnvglfmkmnrviysgqsdiqridifenpdlgvvf
    aldgitmttekdefmyhemlahvpmflhpnpkkvliigggdggtlrevlkhdsvekailc
    evdglvieaarkylkqtscgfddpraeiviangaeyvrkfknefdviiidstdptagqgg
    hlfteefyqacydalkedgvfsaetedpfydigwfklayrriskvfpitrvylgfmttyp
    sgmwsytfaskgidpikdfdpekvrkfnkelkyyneevhvasfalpnfvkkelglm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jq3D (D:)
    lkelerelqprqhlwyfeyytgnnvglfmkmnrviysgqsdiqridifenpdlgvvfald
    gitmttekdefmyhemlahvpmflhpnpkkvliigggdggtlrevlkhdsvekailcevd
    glvieaarkylkqtscgfddpraeiviangaeyvrkfknefdviiidstdptagqgghlf
    teefyqacydalkedgvfsaetedpfydigwfklayrriskvfpitrvylgfmttypsgm
    wsytfaskgidpikdfdpekvrkfnkelkyyneevhvasfalpnfvkkelglm