Lineage for d1jq1b_ (1jq1 B:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629055Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2629056Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
    Pfam PF00520
  5. 2629057Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2629078Protein Potassium channel protein [56901] (3 species)
  7. 2629081Species Streptomyces coelicolor [TaxId:1902] [56902] (26 PDB entries)
    identical sequence to Streptomyces lividans, TaxId: 1916
    Uniprot Q54397 22-124
  8. 2629122Domain d1jq1b_: 1jq1 B: [67072]
    open gate model, residues 86-119; CA-atoms only

Details for d1jq1b_

PDB Entry: 1jq1 (more details)

PDB Description: potassium channel (kcsa) open gate model
PDB Compounds: (B:) Voltage-gated potassium channel

SCOPe Domain Sequences for d1jq1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jq1b_ f.14.1.1 (B:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
lwgrcvavvvmvagitsfglvtaalatwfvgreq

SCOPe Domain Coordinates for d1jq1b_:

Click to download the PDB-style file with coordinates for d1jq1b_.
(The format of our PDB-style files is described here.)

Timeline for d1jq1b_: