Lineage for d1jq1b_ (1jq1 B:)

  1. Root: SCOP 1.59
  2. 141686Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 141752Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 141753Superfamily f.2.1: Membrane all-alpha [56869] (11 families) (S)
  5. 142172Family f.2.1.11: Oligomeric gated channels [63383] (3 proteins)
  6. 142180Protein Potassium chanel protein [56901] (1 species)
  7. 142181Species Streptomyces lividans [TaxId:1916] [56902] (8 PDB entries)
  8. 142205Domain d1jq1b_: 1jq1 B: [67072]

Details for d1jq1b_

PDB Entry: 1jq1 (more details)

PDB Description: potassium channel (kcsa) open gate model

SCOP Domain Sequences for d1jq1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jq1b_ f.2.1.11 (B:) Potassium chanel protein {Streptomyces lividans}
lwgrcvavvvmvagitsfglvtaalatwfvgreq

SCOP Domain Coordinates for d1jq1b_:

Click to download the PDB-style file with coordinates for d1jq1b_.
(The format of our PDB-style files is described here.)

Timeline for d1jq1b_: