SCOPe 2.04: Domain d1jpja1: 1jpj A:1-88

Lineage for d1jpja1 (1jpj A:1-88)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families)

5. Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)

6. Protein Signal sequence recognition protein Ffh [47366] (3 species)

7. Species Thermus aquaticus [TaxId:271] [47367] (17 PDB entries)

8. Domain d1jpja1: 1jpj A:1-88 [67024]
   Other proteins in same PDB: d1jpja2
   complexed with gnp

Details for d1jpja1

PDB Entry: 1jpj, 2.3 Å

PDB Description: GMPPNP Complex of SRP GTPase NG Domain

PDB Compounds: (A:) signal recognition particle protein

SCOPe Domain Sequences for d1jpja1:

Sequence; same for both SEQRES and ATOM records:

>d1jpja1 a.24.13.1 (A:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
gkqvlesltpaevilatvyealkealgg

Timeline for d1jpja1:

• d1jpja1 first appeared in SCOP 1.59
  
• d1jpja1 appears in SCOPe 2.03
  
• d1jpja1 appears in SCOPe 2.05
  
• d1jpja1 appears in the current release, SCOPe 2.08