Lineage for d1jpja1 (1jpj A:1-88)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.24: Four-helical up-and-down bundle [47161] (14 superfamilies) 
Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) 
Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (2 proteins) Protein Signal sequence recognition protein Ffh [47366] (2 species) Species Thermus aquaticus [TaxId:271] [47367] (7 PDB entries) 
Domain d1jpja1: 1jpj A:1-88 [67024]
Other proteins in same PDB: d1jpja2
Details for d1jpja1
PDB Entry: 1jpj (more details), 2.3 Å
PDB Description: GMPPNP Complex of SRP GTPase NG Domain
SCOP Domain Sequences for d1jpja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jpja1 a.24.13.1 (A:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
gkqvlesltpaevilatvyealkealgg
SCOP Domain Coordinates for d1jpja1:
Click to download the PDB-style file with coordinates for d1jpja1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jpja1:
- d1jpja1 is new in SCOP 1.59
- d1jpja1 appears in SCOP 1.61
- d1jpja1 appears in the current release, SCOPe 2.08
View in 3D
