SCOP 1.75: Domain d1jp5b2: 1jp5 B:128-247

Lineage for d1jp5b2 (1jp5 B:128-247)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (32 PDB entries)
   Uniprot P06327 20-117 # HV52_MOUSE (P06327) Ig heavy chain V region VH558 A1/A4 precursor; 57% sequence identity
   Uniprot P01631 # KV2G_MOUSE (P01631) Ig kappa chain V-II region 26-10
   Uniprot P06327 20-117 # HV52_MOUSE (P06327) Ig heavy chain V region VH558 A1/A4 precursor; 57% sequence identity ! Uniprot P01631 # KV2G_MOUSE (P01631) Ig kappa chain V-II region 26-10

8. Domain d1jp5b2: 1jp5 B:128-247 [67004]
   Other proteins in same PDB: d1jp5a1, d1jp5b1
   part of scFv 1695; complexed with the epitope peptide from HIV-1 protease

Details for d1jp5b2

PDB Entry: 1jp5, 2.7 Å

PDB Description: Crystal structure of the single-chain Fv fragment 1696 in complex with the epitope peptide corresponding to N-terminus of HIV-1 protease

PDB Compounds: (B:) single-chain Fv fragment 1696

SCOP Domain Sequences for d1jp5b2:

Sequence; same for both SEQRES and ATOM records:

>d1jp5b2 b.1.1.1 (B:128-247) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
evqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptf
addfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvss

Timeline for d1jp5b2:

• d1jp5b2 first appeared in SCOP 1.59
  
• d1jp5b2 appears in SCOP 1.73
  
• d1jp5b2 appears in SCOPe 2.01
  
• d1jp5b2 appears in the current release, SCOPe 2.08