PDB entry 1jp5

View 1jp5 on RCSB PDB site
Description: Crystal structure of the single-chain Fv fragment 1696 in complex with the epitope peptide corresponding to N-terminus of HIV-1 protease
Class: immune system
Keywords: antibody-antigen complex, HIV PR inhibiting antibody
Deposited on 2001-08-01, released 2001-10-12
The last revision prior to the SCOP 1.75 freeze date was dated 2001-10-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.229
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: single-chain Fv fragment 1696
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1jp5a1, d1jp5a2
  • Chain 'B':
    Compound: single-chain Fv fragment 1696
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1jp5b1, d1jp5b2
  • Chain 'C':
    Compound: epitope peptide corresponding to N-terminus of HIV-1 protease
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: epitope peptide corresponding to N-terminus of HIV-1 protease
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jp5A (A:)
    dilmtqtplylpvslgdqasiscrssqtivhnngntylewylqkpgqspqlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshfpptfgggtkleikggggsggg
    gsggggsevqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwint
    etdeptfaddfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqg
    ttvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jp5A (A:)
    dilmtqtplylpvslgdqasiscrssqtivhnngntylewylqkpgqspqlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshfpptfgggtkleikevqlqqsg
    pelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptfaddfkgrf
    afsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jp5B (B:)
    dilmtqtplylpvslgdqasiscrssqtivhnngntylewylqkpgqspqlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshfpptfgggtkleikggggsggg
    gsggggsevqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwint
    etdeptfaddfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqg
    ttvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jp5B (B:)
    dilmtqtplylpvslgdqasiscrssqtivhnngntylewylqkpgqspqlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshfpptfgggtkleikevqlqqsg
    pelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptfaddfkgrf
    afsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvss
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.