SCOPe 2.08: Domain d1jnya1: 1jny A:228-322

Lineage for d1jnya1 (1jny A:228-322)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.1: Elongation factors [50448] (11 proteins)

6. Protein Elongation factor eEF-1alpha, domain 2 [50454] (2 species)
   eukaryotic and archaeal homologue of EF-Tu

7. Species Sulfolobus solfataricus [TaxId:2287] [69276] (2 PDB entries)
   Uniprot P35021

8. Domain d1jnya1: 1jny A:228-322 [66982]
   Other proteins in same PDB: d1jnya2, d1jnya3, d1jnyb2, d1jnyb3
   complexed with gdp

Details for d1jnya1

PDB Entry: 1jny, 1.8 Å

PDB Description: Crystal structure of Sulfolobus solfataricus elongation factor 1 alpha in complex with GDP

PDB Compounds: (A:) Elongation factor 1-alpha

SCOPe Domain Sequences for d1jnya1:

Sequence; same for both SEQRES and ATOM records:

>d1jnya1 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, domain 2 {Sulfolobus solfataricus [TaxId: 2287]}
pvdkplripiqdvysisgvgtvpvgrvesgvlkvgdkivfmpagkvgevrsiethhtkmd
kaepgdnigfnvrgvekkdikrgdvvghpnnpptv

Timeline for d1jnya1:

• d1jnya1 first appeared in SCOP 1.59
  
• d1jnya1 appears in SCOPe 2.07