Lineage for d1jnyb2 (1jny B:323-430)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2793864Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793865Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2793866Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)
  6. 2793867Protein Elongation factor eEF-1alpha, C-terminal domain [50472] (2 species)
    eukaryotic and archaeal homologue of EF-Tu
  7. 2793875Species Sulfolobus solfataricus [TaxId:2287] [69277] (2 PDB entries)
    Uniprot P35021
  8. 2793877Domain d1jnyb2: 1jny B:323-430 [66986]
    Other proteins in same PDB: d1jnya1, d1jnya3, d1jnyb1, d1jnyb3
    complexed with gdp

Details for d1jnyb2

PDB Entry: 1jny (more details), 1.8 Å

PDB Description: Crystal structure of Sulfolobus solfataricus elongation factor 1 alpha in complex with GDP
PDB Compounds: (B:) Elongation factor 1-alpha

SCOPe Domain Sequences for d1jnyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnyb2 b.44.1.1 (B:323-430) Elongation factor eEF-1alpha, C-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
adeftariivvwhptalangytpvlhvhtasvacrvselvskldprtgqeaeknpqflkq
gdvaivkfkpikplcvekynefpplgrfamrdmgktvgvgiivdvkpa

SCOPe Domain Coordinates for d1jnyb2:

Click to download the PDB-style file with coordinates for d1jnyb2.
(The format of our PDB-style files is described here.)

Timeline for d1jnyb2: