Lineage for d1jm7a_ (1jm7 A:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1465026Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 1465027Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 1465028Family g.44.1.1: RING finger domain, C3HC4 [57851] (14 proteins)
  6. 1465038Protein brca1 RING domain [69968] (1 species)
  7. 1465039Species Human (Homo sapiens) [TaxId:9606] [69969] (1 PDB entry)
  8. 1465040Domain d1jm7a_: 1jm7 A: [66880]
    Other proteins in same PDB: d1jm7b_
    heterodimer with bard1 RING domain
    complexed with zn

Details for d1jm7a_

PDB Entry: 1jm7 (more details)

PDB Description: solution structure of the brca1/bard1 ring-domain heterodimer
PDB Compounds: (A:) breast cancer type 1 susceptibility protein

SCOPe Domain Sequences for d1jm7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]}
mdlsalrveevqnvinamqkilecpiclelikepvstkcdhifckfcmlkllnqkkgpsq
cplcknditkrslqestrfsqlveellkiicafqldtgleyan

SCOPe Domain Coordinates for d1jm7a_:

Click to download the PDB-style file with coordinates for d1jm7a_.
(The format of our PDB-style files is described here.)

Timeline for d1jm7a_: