Lineage for d1jm7a_ (1jm7 A:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 145140Fold g.44: RING finger domain, C3HC4 [57849] (1 superfamily)
  4. 145141Superfamily g.44.1: RING finger domain, C3HC4 [57850] (1 family) (S)
  5. 145142Family g.44.1.1: RING finger domain, C3HC4 [57851] (8 proteins)
  6. 145149Protein brca1 RING domain [69968] (1 species)
  7. 145150Species Human (Homo sapiens) [TaxId:9606] [69969] (1 PDB entry)
  8. 145151Domain d1jm7a_: 1jm7 A: [66880]
    Other proteins in same PDB: d1jm7b_

Details for d1jm7a_

PDB Entry: 1jm7 (more details)

PDB Description: solution structure of the brca1/bard1 ring-domain heterodimer

SCOP Domain Sequences for d1jm7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens)}
mdlsalrveevqnvinamqkilecpiclelikepvstkcdhifckfcmlkllnqkkgpsq
cplcknditkrslqestrfsqlveellkiicafqldtgleyan

SCOP Domain Coordinates for d1jm7a_:

Click to download the PDB-style file with coordinates for d1jm7a_.
(The format of our PDB-style files is described here.)

Timeline for d1jm7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jm7b_