SCOPe 2.04: Domain d1jkya3: 1jky A:264-550

Lineage for d1jkya3 (1jky A:264-550)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)

6. Protein Anthrax toxin lethal factor, middle domain [69845] (1 species)
   includes an all-alpha insert subdomain

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [69846] (9 PDB entries)

8. Domain d1jkya3: 1jky A:264-550 [66819]
   Other proteins in same PDB: d1jkya1, d1jkya2

Details for d1jkya3

PDB Entry: 1jky, 3.9 Å

PDB Description: crystal structure of the anthrax lethal factor (lf): wild-type lf complexed with the n-terminal sequence of mapkk2

PDB Compounds: (A:) Lethal Factor

SCOPe Domain Sequences for d1jkya3:

Sequence; same for both SEQRES and ATOM records:

>d1jkya3 d.166.1.1 (A:264-550) Anthrax toxin lethal factor, middle domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mlsryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeekellkriq
idssdflsteekeflkklqidirdslseeekellnriqvdssnplsekekeflkklkldi
qpydinqrlqdtgglidspsinldvrkqykrdiqnidallhqsigstlynkiylyenmni
nnltatlgadlvdstdntkinrgifnefkknfkysissnymivdinerpaldnerlkwri
qlspdtragylengklilqrnigleikdvqiikqsekeyiridakvv

Timeline for d1jkya3:

• d1jkya3 first appeared in SCOP 1.59
  
• d1jkya3 appears in SCOPe 2.03
  
• d1jkya3 appears in SCOPe 2.05
  
• d1jkya3 appears in the current release, SCOPe 2.08