SCOPe 2.04: Domain d1jkya1: 1jky A:29-263

Lineage for d1jkya1 (1jky A:29-263)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (2 proteins)
   automatically mapped to Pfam PF07737

6. Protein Anthrax toxin lethal factor, N- and C-terminal domains [69776] (1 species)
   duplication: each domain adopts a thermolysin-like fold, but the proteolytic activity resides only in the C-terminal domain

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [69777] (9 PDB entries)

8. Domain d1jkya1: 1jky A:29-263 [66817]
   Other proteins in same PDB: d1jkya3
   complexed with the n-terminal peptide of mapkk2

Details for d1jkya1

PDB Entry: 1jky, 3.9 Å

PDB Description: crystal structure of the anthrax lethal factor (lf): wild-type lf complexed with the n-terminal sequence of mapkk2

PDB Compounds: (A:) Lethal Factor

SCOPe Domain Sequences for d1jkya1:

Sequence; same for both SEQRES and ATOM records:

>d1jkya1 d.92.1.14 (A:29-263) Anthrax toxin lethal factor, N- and C-terminal domains {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
nktqeehlkeimkhivkievkgeeavkkeaaekllekvpsdvlemykaiggkiyivdgdi
tkhislealsedkkkikdiygkdallhehyvyakegyepvlviqssedyventekalnvy
yeigkilsrdilskinqpyqkfldvlntiknasdsdgqdllftnqlkehptdfsvefleq
nsnevqevfakafayyiepqhrdvlqlyapeafnymdkfneqeinlsleelkdqr

Timeline for d1jkya1:

• d1jkya1 first appeared in SCOP 1.59
  
• d1jkya1 appears in SCOPe 2.03
  
• d1jkya1 appears in SCOPe 2.05
  
• d1jkya1 appears in the current release, SCOPe 2.08