Lineage for d1jkga_ (1jkg A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.17: Cystatin-like [54402] (5 superfamilies) Superfamily d.17.4: NTF2-like [54427] (4 families) 
Family d.17.4.2: NTF2-like [54431] (3 proteins) Protein NTF2-related export protein 1 (p15) [69675] (1 species) Species Human (Homo sapiens) [TaxId:9606] [69676] (2 PDB entries) 
Domain d1jkga_: 1jkg A: [66795]
Other proteins in same PDB: d1jkgb_
Details for d1jkga_
PDB Entry: 1jkg (more details), 1.9 Å
PDB Description: Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain of TAP-p15 mRNA nuclear export factor
SCOP Domain Sequences for d1jkga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens)}
asvdfktyvdqacraaeefvnvyyttmdkrrrllsrlymgtatlvwngnavsgqeslsef
femlpssefqisvvdcqpvhdeatpsqttvlvvicgsvkfegnkqrdfnqnfiltaqasp
sntvwkiasdcfrfqdwas
SCOP Domain Coordinates for d1jkga_:
Click to download the PDB-style file with coordinates for d1jkga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jkga_:
- d1jkga_ is new in SCOP 1.59
- d1jkga_ appears in SCOP 1.61
- d1jkga_ appears in the current release, SCOPe 2.08
View in 3D
