Lineage for d1jkga_ (1jkg A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 131584Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 131706Superfamily d.17.4: NTF2-like [54427] (4 families) (S)
  5. 131727Family d.17.4.2: NTF2-like [54431] (3 proteins)
  6. 131732Protein NTF2-related export protein 1 (p15) [69675] (1 species)
  7. 131733Species Human (Homo sapiens) [TaxId:9606] [69676] (2 PDB entries)
  8. 131734Domain d1jkga_: 1jkg A: [66795]
    Other proteins in same PDB: d1jkgb_

Details for d1jkga_

PDB Entry: 1jkg (more details), 1.9 Å

PDB Description: Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain of TAP-p15 mRNA nuclear export factor

SCOP Domain Sequences for d1jkga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens)}
asvdfktyvdqacraaeefvnvyyttmdkrrrllsrlymgtatlvwngnavsgqeslsef
femlpssefqisvvdcqpvhdeatpsqttvlvvicgsvkfegnkqrdfnqnfiltaqasp
sntvwkiasdcfrfqdwas

SCOP Domain Coordinates for d1jkga_:

Click to download the PDB-style file with coordinates for d1jkga_.
(The format of our PDB-style files is described here.)

Timeline for d1jkga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jkgb_