Lineage for d1jkga_ (1jkg A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936311Family d.17.4.2: NTF2-like [54431] (6 proteins)
  6. 2936329Protein NTF2-related export protein 1 (p15) [69675] (1 species)
  7. 2936330Species Human (Homo sapiens) [TaxId:9606] [69676] (2 PDB entries)
  8. 2936331Domain d1jkga_: 1jkg A: [66795]
    Other proteins in same PDB: d1jkgb1, d1jkgb2

Details for d1jkga_

PDB Entry: 1jkg (more details), 1.9 Å

PDB Description: Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain of TAP-p15 mRNA nuclear export factor
PDB Compounds: (A:) p15

SCOPe Domain Sequences for d1jkga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]}
asvdfktyvdqacraaeefvnvyyttmdkrrrllsrlymgtatlvwngnavsgqeslsef
femlpssefqisvvdcqpvhdeatpsqttvlvvicgsvkfegnkqrdfnqnfiltaqasp
sntvwkiasdcfrfqdwas

SCOPe Domain Coordinates for d1jkga_:

Click to download the PDB-style file with coordinates for d1jkga_.
(The format of our PDB-style files is described here.)

Timeline for d1jkga_: