Class a: All alpha proteins [46456] (179 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (9 superfamilies) not a true fold |
Superfamily a.137.9: Quinohemoprotein amine dehydrogenase C chain [69131] (1 family) |
Family a.137.9.1: Quinohemoprotein amine dehydrogenase C chain [69132] (1 protein) |
Protein Quinohemoprotein amine dehydrogenase C chain [69133] (2 species) |
Species Paracoccus denitrificans [TaxId:266] [69134] (1 PDB entry) |
Domain d1jjuc_: 1jju C: [66780] Other proteins in same PDB: d1jjua1, d1jjua2, d1jjua3, d1jjua4, d1jjua5, d1jjub_ complexed with hem, na, tbu, trq |
PDB Entry: 1jju (more details), 2.05 Å
SCOP Domain Sequences for d1jjuc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jjuc_ a.137.9.1 (C:) Quinohemoprotein amine dehydrogenase C chain {Paracoccus denitrificans} mnalvgcttsfdpgwevdafgavsnlcqpmeadlygcadpcwxpaqvadtlntypnwsag addvmqdwrklqsvfpetk
Timeline for d1jjuc_: