Lineage for d1jjuc_ (1jju C:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 361507Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (10 superfamilies)
    not a true fold
  4. 361589Superfamily a.137.9: Quinohemoprotein amine dehydrogenase C chain [69131] (1 family) (S)
  5. 361590Family a.137.9.1: Quinohemoprotein amine dehydrogenase C chain [69132] (1 protein)
  6. 361591Protein Quinohemoprotein amine dehydrogenase C chain [69133] (2 species)
  7. 361592Species Paracoccus denitrificans [TaxId:266] [69134] (2 PDB entries)
  8. 361594Domain d1jjuc_: 1jju C: [66780]
    Other proteins in same PDB: d1jjua1, d1jjua2, d1jjua3, d1jjua4, d1jjua5, d1jjub_
    complexed with hem, na, tbu, trq

Details for d1jjuc_

PDB Entry: 1jju (more details), 2.05 Å

PDB Description: Structure of a Quinohemoprotein Amine Dehydrogenase with a Unique Redox Cofactor and Highly Unusual Crosslinking

SCOP Domain Sequences for d1jjuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjuc_ a.137.9.1 (C:) Quinohemoprotein amine dehydrogenase C chain {Paracoccus denitrificans}
mnalvgcttsfdpgwevdafgavsnlcqpmeadlygcadpcwxpaqvadtlntypnwsag
addvmqdwrklqsvfpetk

SCOP Domain Coordinates for d1jjuc_:

Click to download the PDB-style file with coordinates for d1jjuc_.
(The format of our PDB-style files is described here.)

Timeline for d1jjuc_: