![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.137.9: Quinohemoprotein amine dehydrogenase C chain [69131] (1 family) ![]() automatically mapped to Pfam PF08992 |
![]() | Family a.137.9.1: Quinohemoprotein amine dehydrogenase C chain [69132] (1 protein) |
![]() | Protein Quinohemoprotein amine dehydrogenase C chain [69133] (2 species) |
![]() | Species Paracoccus denitrificans [TaxId:266] [69134] (2 PDB entries) |
![]() | Domain d1jjuc_: 1jju C: [66780] Other proteins in same PDB: d1jjua1, d1jjua2, d1jjua3, d1jjua4, d1jjua5, d1jjub_ complexed with hem, na, tbu |
PDB Entry: 1jju (more details), 2.05 Å
SCOPe Domain Sequences for d1jjuc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jjuc_ a.137.9.1 (C:) Quinohemoprotein amine dehydrogenase C chain {Paracoccus denitrificans [TaxId: 266]} mnalvgcttsfdpgwevdafgavsnlcqpmeadlygcadpcwwpaqvadtlntypnwsag addvmqdwrklqsvfpetk
Timeline for d1jjuc_: