Lineage for d1jjuc_ (1jju C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733906Superfamily a.137.9: Quinohemoprotein amine dehydrogenase C chain [69131] (1 family) (S)
    automatically mapped to Pfam PF08992
  5. 2733907Family a.137.9.1: Quinohemoprotein amine dehydrogenase C chain [69132] (1 protein)
  6. 2733908Protein Quinohemoprotein amine dehydrogenase C chain [69133] (2 species)
  7. 2733909Species Paracoccus denitrificans [TaxId:266] [69134] (2 PDB entries)
  8. 2733911Domain d1jjuc_: 1jju C: [66780]
    Other proteins in same PDB: d1jjua1, d1jjua2, d1jjua3, d1jjua4, d1jjua5, d1jjub_
    complexed with hem, na, tbu

Details for d1jjuc_

PDB Entry: 1jju (more details), 2.05 Å

PDB Description: Structure of a Quinohemoprotein Amine Dehydrogenase with a Unique Redox Cofactor and Highly Unusual Crosslinking
PDB Compounds: (C:) quinohemoprotein amine dehydrogenase

SCOPe Domain Sequences for d1jjuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjuc_ a.137.9.1 (C:) Quinohemoprotein amine dehydrogenase C chain {Paracoccus denitrificans [TaxId: 266]}
mnalvgcttsfdpgwevdafgavsnlcqpmeadlygcadpcwwpaqvadtlntypnwsag
addvmqdwrklqsvfpetk

SCOPe Domain Coordinates for d1jjuc_:

Click to download the PDB-style file with coordinates for d1jjuc_.
(The format of our PDB-style files is described here.)

Timeline for d1jjuc_: