Class b: All beta proteins [48724] (165 folds) |
Fold b.40: OB-fold [50198] (12 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) |
Family b.40.4.4: Myf domain [50277] (6 proteins) |
Protein Domain B2 of PheRS-beta, PheT [50278] (1 species) |
Species Thermus thermophilus [TaxId:274] [50279] (9 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
Domain d1jjcb3: 1jjc B:39-151 [66761] Other proteins in same PDB: d1jjca_, d1jjcb1, d1jjcb2, d1jjcb4, d1jjcb5, d1jjcb6 complexed with fa5, mn, so4 |
PDB Entry: 1jjc (more details), 2.6 Å
SCOP Domain Sequences for d1jjcb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jjcb3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]} fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp
Timeline for d1jjcb3: