SCOP 1.59: Domain d1jjcb3: 1jjc B:39-151

Lineage for d1jjcb3 (1jjc B:39-151)

Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds)
Fold b.40: OB-fold [50198] (8 superfamilies)
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (9 families)
Family b.40.4.4: Myf domain [50277] (3 proteins)
Protein Domain B2 of PheRS-beta, PheT [50278] (1 species)
Species Thermus thermophilus (Thermus aquaticus) [50279] (5 PDB entries)
Domain d1jjcb3: 1jjc B:39-151 [66761]
Other proteins in same PDB: d1jjca_, d1jjcb1, d1jjcb2, d1jjcb4, d1jjcb5, d1jjcb6

Details for d1jjcb3

PDB Entry: 1jjc (more details), 2.6 Å

PDB Description: Crystal structure at 2.6A resolution of phenylalanyl-tRNA synthetase complexed with phenylalanyl-adenylate in the presence of manganese

SCOP Domain Sequences for d1jjcb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjcb3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp

SCOP Domain Coordinates for d1jjcb3:

Click to download the PDB-style file with coordinates for d1jjcb3.
(The format of our PDB-style files is described here.)

Timeline for d1jjcb3: