SCOP 1.63: Domain d1jieb_: 1jie B:

Lineage for d1jieb_ (1jie B:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families)

5. Family d.32.1.2: Antibiotic resistance proteins [54598] (3 proteins)
   duplication: consists of two clear structural repeats each having this fold
   subunit fold and dimeric assembly are similar to those of glyoxalase

6. Protein Bleomycin resistance protein, BRP [54599] (3 species)
   Active as dimer

7. Species Streptomyces verticillus [TaxId:29309] [54600] (3 PDB entries)

8. Domain d1jieb_: 1jie B: [66737]
   complexed with blm

Details for d1jieb_

PDB Entry: 1jie, 1.8 Å

PDB Description: crystal structure of bleomycin-binding protein from bleomycin- producing streptomyces verticillus complexed with metal-free bleomycin

SCOP Domain Sequences for d1jieb_:

Sequence; same for both SEQRES and ATOM records:

>d1jieb_ d.32.1.2 (B:) Bleomycin resistance protein, BRP {Streptomyces verticillus}
mvkflgavpvltavdvpanvsfwvdtlgfekdfgdrdfagvrrgdirlhisrtehqivad
ntsawievtdpdalheewaravstdyadtsgpamtpvgespagrefavrdpagncvhfta
ge

Timeline for d1jieb_:

• d1jieb_ first appeared in SCOP 1.59
  
• d1jieb_ appears in SCOP 1.61
  
• d1jieb_ appears in SCOP 1.65
  
• d1jieb_ appears in the current release, SCOPe 2.08