Lineage for d1ji8a_ (1ji8 A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.203: DsrC, the gamma subunit of dissimilatory sulfite reductase [69720] (1 superfamily) Superfamily d.203.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69721] (1 family) 
Family d.203.1.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69722] (1 protein) Protein DsrC, the gamma subunit of dissimilatory sulfite reductase [69723] (1 species) Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [69724] (1 PDB entry) 
Domain d1ji8a_: 1ji8 A: [66733]
Details for d1ji8a_
PDB Entry: 1ji8 (more details)
PDB Description: solution structure of pyrobaculum aerophilum dsrc/gamma subunit of dissimilatory sulfite reductase
SCOP Domain Sequences for d1ji8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ji8a_ d.203.1.1 (A:) DsrC, the gamma subunit of dissimilatory sulfite reductase {Archaeon Pyrobaculum aerophilum}
mpvkcpgeyqvdgkkvildedcfmqnpedwdekvaewlarelegiqkmteehwklvkylr
eywetfgtcppikmvtketgfslekiyqlfpsgpahgackvagapkptgcv
SCOP Domain Coordinates for d1ji8a_:
Click to download the PDB-style file with coordinates for d1ji8a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ji8a_:
- d1ji8a_ is new in SCOP 1.59
- d1ji8a_ appears in SCOP 1.61
- d1ji8a_ appears in the current release, SCOPe 2.08
View in 3D