Lineage for d1ji8a_ (1ji8 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006154Fold d.203: DsrC, the gamma subunit of dissimilatory sulfite reductase [69720] (1 superfamily)
    beta(3)-alpha(5); meander beta-sheet packed against array of helices
  4. 3006155Superfamily d.203.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69721] (2 families) (S)
  5. 3006156Family d.203.1.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69722] (2 proteins)
    automatically mapped to Pfam PF04358
  6. 3006157Protein DsrC, the gamma subunit of dissimilatory sulfite reductase [69723] (4 species)
  7. 3006167Species Pyrobaculum aerophilum [TaxId:13773] [69724] (1 PDB entry)
  8. 3006168Domain d1ji8a_: 1ji8 A: [66733]

Details for d1ji8a_

PDB Entry: 1ji8 (more details)

PDB Description: solution structure of pyrobaculum aerophilum dsrc/gamma subunit of dissimilatory sulfite reductase
PDB Compounds: (A:) dissimilatory siroheme-sulfite reductase

SCOPe Domain Sequences for d1ji8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ji8a_ d.203.1.1 (A:) DsrC, the gamma subunit of dissimilatory sulfite reductase {Pyrobaculum aerophilum [TaxId: 13773]}
mpvkcpgeyqvdgkkvildedcfmqnpedwdekvaewlarelegiqkmteehwklvkylr
eywetfgtcppikmvtketgfslekiyqlfpsgpahgackvagapkptgcv

SCOPe Domain Coordinates for d1ji8a_:

Click to download the PDB-style file with coordinates for d1ji8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ji8a_: