Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.203: DsrC, the gamma subunit of dissimilatory sulfite reductase [69720] (1 superfamily) beta(3)-alpha(5); meander beta-sheet packed against array of helices |
Superfamily d.203.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69721] (2 families) |
Family d.203.1.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69722] (2 proteins) automatically mapped to Pfam PF04358 |
Protein DsrC, the gamma subunit of dissimilatory sulfite reductase [69723] (4 species) |
Species Pyrobaculum aerophilum [TaxId:13773] [69724] (1 PDB entry) |
Domain d1ji8a_: 1ji8 A: [66733] |
PDB Entry: 1ji8 (more details)
SCOPe Domain Sequences for d1ji8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ji8a_ d.203.1.1 (A:) DsrC, the gamma subunit of dissimilatory sulfite reductase {Pyrobaculum aerophilum [TaxId: 13773]} mpvkcpgeyqvdgkkvildedcfmqnpedwdekvaewlarelegiqkmteehwklvkylr eywetfgtcppikmvtketgfslekiyqlfpsgpahgackvagapkptgcv
Timeline for d1ji8a_: