Class b: All beta proteins [48724] (177 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Amylosucrase [69328] (1 species) |
Species Neisseria polysaccharea [TaxId:489] [69329] (10 PDB entries) |
Domain d1jgia1: 1jgi A:555-628 [66676] Other proteins in same PDB: d1jgia2, d1jgia3 complexed with suc; mutant |
PDB Entry: 1jgi (more details), 2 Å
SCOPe Domain Sequences for d1jgia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jgia1 b.71.1.1 (A:555-628) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} rlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfkahdliggktvslnqd ltlqpyqvmwleia
Timeline for d1jgia1: