Lineage for d1jgia1 (1jgi A:555-628)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily) Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) 
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (12 proteins) 
Protein Amylosucrase [69328] (1 species) Species Neisseria polysaccharea [TaxId:489] [69329] (3 PDB entries) 
Domain d1jgia1: 1jgi A:555-628 [66676]
Other proteins in same PDB: d1jgia2
Details for d1jgia1
PDB Entry: 1jgi (more details), 2 Å
PDB Description: crystal structure of the active site mutant glu328gln of amylosucrase from neisseria polysaccharea in complex with the natural substrate sucrose
SCOP Domain Sequences for d1jgia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jgia1 b.71.1.1 (A:555-628) Amylosucrase {Neisseria polysaccharea}
rlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfkahdliggktvslnqd
ltlqpyqvmwleia
SCOP Domain Coordinates for d1jgia1:
Click to download the PDB-style file with coordinates for d1jgia1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jgia1:
- d1jgia1 is new in SCOP 1.59
- d1jgia1 appears in SCOP 1.61
- d1jgia1 appears in the current release, SCOPe 2.08
View in 3D
