SCOPe 2.06: Domain d1jg5c_: 1jg5 C:

Lineage for d1jg5c_ (1jg5 C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.205: GTP cyclohydrolase I feedback regulatory protein, GFRP [69760] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta, antiparallel beta-sheet: order 342165

4. Superfamily d.205.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69761] (1 family)
   automatically mapped to Pfam PF06399

5. Family d.205.1.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69762] (1 protein)

6. Protein GTP cyclohydrolase I feedback regulatory protein, GFRP [69763] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [69764] (4 PDB entries)
   Uniprot P70552

8. Domain d1jg5c_: 1jg5 C: [66668]
   complexed with k

Details for d1jg5c_

PDB Entry: 1jg5, 2.6 Å

PDB Description: crystal structure of rat gtp cyclohydrolase i feedback regulatory protein, gfrp

PDB Compounds: (C:) GTP Cyclohydrolase I Feedback Regulatory Protein

SCOPe Domain Sequences for d1jg5c_:

Sequence; same for both SEQRES and ATOM records:

>d1jg5c_ d.205.1.1 (C:) GTP cyclohydrolase I feedback regulatory protein, GFRP {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkle
crgfrvlsmtgvgqtlvwclhke

Timeline for d1jg5c_:

• d1jg5c_ first appeared in SCOP 1.59
  
• d1jg5c_ appears in SCOPe 2.05
  
• d1jg5c_ appears in SCOPe 2.07
  
• d1jg5c_ appears in the current release, SCOPe 2.08