PDB entry 1jg5

View 1jg5 on RCSB PDB site
Description: crystal structure of rat GTP cyclohydrolase I feedback regulatory protein, gfrp
Class: protein binding
Keywords: alpha/beta structure, beta sheet, PROTEIN BINDING
Deposited on 2001-06-23, released 2001-10-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.166
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: GTP Cyclohydrolase I Feedback Regulatory Protein
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P70552 (0-82)
  Domains in SCOPe 2.06: d1jg5a_
• Chain 'B':
  Compound: GTP Cyclohydrolase I Feedback Regulatory Protein
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P70552 (0-82)
  Domains in SCOPe 2.06: d1jg5b_
• Chain 'C':
  Compound: GTP Cyclohydrolase I Feedback Regulatory Protein
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P70552 (0-82)
  Domains in SCOPe 2.06: d1jg5c_
• Chain 'D':
  Compound: GTP Cyclohydrolase I Feedback Regulatory Protein
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P70552 (0-82)
  Domains in SCOPe 2.06: d1jg5d_
• Chain 'E':
  Compound: GTP Cyclohydrolase I Feedback Regulatory Protein
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P70552 (0-82)
  Domains in SCOPe 2.06: d1jg5e_
• Heterogens: K, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jg5A (A:)
  pyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkle
  crgfrvlsmtgvgqtlvwclhke
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jg5B (B:)
  pyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkle
  crgfrvlsmtgvgqtlvwclhke
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jg5C (C:)
  pyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkle
  crgfrvlsmtgvgqtlvwclhke
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jg5D (D:)
  pyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkle
  crgfrvlsmtgvgqtlvwclhke
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jg5E (E:)
  pyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkle
  crgfrvlsmtgvgqtlvwclhke