SCOPe 2.07: Domain d1jdid_: 1jdi D:

Lineage for d1jdid_ (1jdi D:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily)
   3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5

4. Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (3 families)

5. Family c.74.1.1: AraD-like aldolase/epimerase [53640] (5 proteins)
   metal (zinc)-ion dependent

6. Protein L-ribulose-5-phosphate 4-epimerase [69597] (1 species)

7. Species Escherichia coli [TaxId:562] [69598] (2 PDB entries)

8. Domain d1jdid_: 1jdi D: [66554]
   complexed with zn

Details for d1jdid_

PDB Entry: 1jdi, 2.4 Å

PDB Description: crystal structure of l-ribulose-5-phosphate 4-epimerase

PDB Compounds: (D:) l-ribulose 5 phosphate 4-epimerase

SCOPe Domain Sequences for d1jdid_:

Sequence; same for both SEQRES and ATOM records:

>d1jdid_ c.74.1.1 (D:) L-ribulose-5-phosphate 4-epimerase {Escherichia coli [TaxId: 562]}
mledlkrqvleanlalpkhnlvtltwgnvsavdrergvfvikpsgvdysimtaddmvvvs
ietgevvegakkpssdtpthrllyqafpsiggivhthsrhatiwaqagqsipatgtthad
yfygtipctrkmtdaeingeyewetgnvivetfekqgidaaqmpgvlvhshgpfawgkna
edavhnaivleevaymgifcrqlapqlpdmqqtllnkhylrkh

Timeline for d1jdid_:

• d1jdid_ first appeared in SCOP 1.59
  
• d1jdid_ appears in SCOPe 2.06
  
• d1jdid_ appears in the current release, SCOPe 2.08