Lineage for d1jd2p_ (1jd2 P:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 197693Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
  4. 197694Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 197799Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 197868Protein Proteasome alpha subunit (non-catalytic) [56255] (3 species)
  7. 197884Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (4 PDB entries)
  8. 197935Domain d1jd2p_: 1jd2 P: [66531]
    Other proteins in same PDB: d1jd21_, d1jd22_, d1jd2h_, d1jd2i_, d1jd2j_, d1jd2k_, d1jd2l_, d1jd2m_, d1jd2n_, d1jd2v_, d1jd2w_, d1jd2x_, d1jd2y_, d1jd2z_

Details for d1jd2p_

PDB Entry: 1jd2 (more details), 3 Å

PDB Description: crystal structure of the yeast 20s proteasome:tmc-95a complex: a non- covalent proteasome inhibitor

SCOP Domain Sequences for d1jd2p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jd2p_ d.153.1.4 (P:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae)}
sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
gwgavvyiikkdevvkrylkmrqd

SCOP Domain Coordinates for d1jd2p_:

Click to download the PDB-style file with coordinates for d1jd2p_.
(The format of our PDB-style files is described here.)

Timeline for d1jd2p_: