Lineage for d1jd2l_ (1jd2 L:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 197693Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
  4. 197694Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 197799Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 197956Protein Proteasome beta subunit (catalytic) [56252] (3 species)
  7. 197972Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (4 PDB entries)
  8. 198021Domain d1jd2l_: 1jd2 L: [66527]
    Other proteins in same PDB: d1jd2a_, d1jd2b_, d1jd2c_, d1jd2d_, d1jd2e_, d1jd2f_, d1jd2g_, d1jd2o_, d1jd2p_, d1jd2q_, d1jd2r_, d1jd2s_, d1jd2t_, d1jd2u_

Details for d1jd2l_

PDB Entry: 1jd2 (more details), 3 Å

PDB Description: crystal structure of the yeast 20s proteasome:tmc-95a complex: a non- covalent proteasome inhibitor

SCOP Domain Sequences for d1jd2l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jd2l_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae)}
qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd

SCOP Domain Coordinates for d1jd2l_:

Click to download the PDB-style file with coordinates for d1jd2l_.
(The format of our PDB-style files is described here.)

Timeline for d1jd2l_: