Lineage for d1jclb_ (1jcl B:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) 
Superfamily c.1.10: Aldolase [51569] (4 families) 
Family c.1.10.1: Class I aldolase [51570] (7 proteins) Protein Deoxyribose-phosphate aldolase DeoC [69394] (1 species) Species Escherichia coli [TaxId:562] [69395] (2 PDB entries) 
Domain d1jclb_: 1jcl B: [66502]
Details for d1jclb_
PDB Entry: 1jcl (more details), 1.05 Å
PDB Description: observation of covalent intermediates in an enzyme mechanism at atomic resolution
SCOP Domain Sequences for d1jclb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jclb_ c.1.10.1 (B:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli}
hmtdlkasslralklmdlttlndddtdekvialchqaktpvgntaaiciyprfipiarkt
lkeqgtpeiriatvtnfphgnddidialaetraaiaygadevdvvfpyralmagneqvgf
dlvkackeacaaanvllkviietgelkdealirkaseisikagadfiktstgkvavnatp
esarimmevirdmgvektvgfkpaggvrtaedaqkylaiadelfgadwadarhyrfgass
llasllkalgh
SCOP Domain Coordinates for d1jclb_:
Click to download the PDB-style file with coordinates for d1jclb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jclb_:
- d1jclb_ is new in SCOP 1.59
- d1jclb_ appears in SCOP 1.61
- d1jclb_ appears in the current release, SCOPe 2.08, called d1jclb1
View in 3D
