PDB entry 1jcl

View 1jcl on RCSB PDB site
Description: observation of covalent intermediates in an enzyme mechanism at atomic resolution
Deposited on 2001-06-09, released 2001-10-31
The last revision prior to the SCOP 1.59 freeze date was dated 2001-10-31, with a file datestamp of 2001-10-31.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.143
AEROSPACI score: 0.98 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1jcla_
  • Chain 'B':
    Domains in SCOP 1.59: d1jclb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jclA (A:)
    hmtdlkasslralklmdlttlndddtdekvialchqaktpvgntaaiciyprfipiarkt
    lkeqgtpeiriatvtnfphgnddidialaetraaiaygadevdvvfpyralmagneqvgf
    dlvkackeacaaanvllkviietgelkdealirkaseisikagadfiktstgkvavnatp
    esarimmevirdmgvektvgfkpaggvrtaedaqkylaiadelfgadwadarhyrfgass
    llasllkalghg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jclB (B:)
    hmtdlkasslralklmdlttlndddtdekvialchqaktpvgntaaiciyprfipiarkt
    lkeqgtpeiriatvtnfphgnddidialaetraaiaygadevdvvfpyralmagneqvgf
    dlvkackeacaaanvllkviietgelkdealirkaseisikagadfiktstgkvavnatp
    esarimmevirdmgvektvgfkpaggvrtaedaqkylaiadelfgadwadarhyrfgass
    llasllkalgh