Lineage for d1jadb_ (1jad B:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2646825Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 2646940Superfamily h.4.10: C-terminal domain of PLC-beta [69989] (1 family) (S)
    left-handed antiparallel coiled-coil; dimerizes with the formation of a 4-helical bundle
  5. 2646941Family h.4.10.1: C-terminal domain of PLC-beta [69990] (1 protein)
  6. 2646942Protein C-terminal domain of PLC-beta [69991] (1 species)
  7. 2646943Species Turkey (Meleagris gallopavo) [TaxId:9103] [69992] (1 PDB entry)
  8. 2646945Domain d1jadb_: 1jad B: [66462]
    CASP4
    complexed with so4

Details for d1jadb_

PDB Entry: 1jad (more details), 2.4 Å

PDB Description: C-terminal Domain of Turkey PLC-beta
PDB Compounds: (B:) phospholipase C beta

SCOPe Domain Sequences for d1jadb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jadb_ h.4.10.1 (B:) C-terminal domain of PLC-beta {Turkey (Meleagris gallopavo) [TaxId: 9103]}
nmkevtqlpepqtaslaelqqmklflkllkkqekelkelerkgskrreellqkysvlfle
pvyprgldsqvvelkerlemelihlgeeyhdgirrrkeqhateqtakitelarekqiael
kalkessesnikdikkkleakrldriqvmmrstsdkaaqerlkkeinnshiqevvqtikl
ltektaryqqkleekqaenlraiqekegqlqqeavaeyeeklktltvevqemvknymkev
fp

SCOPe Domain Coordinates for d1jadb_:

Click to download the PDB-style file with coordinates for d1jadb_.
(The format of our PDB-style files is described here.)

Timeline for d1jadb_: