Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies) this is not a true fold; contains at least two very long antiparallel helices |
Superfamily h.4.10: C-terminal domain of PLC-beta [69989] (1 family) left-handed antiparallel coiled-coil; dimerizes with the formation of a 4-helical bundle |
Family h.4.10.1: C-terminal domain of PLC-beta [69990] (1 protein) |
Protein C-terminal domain of PLC-beta [69991] (1 species) |
Species Turkey (Meleagris gallopavo) [TaxId:9103] [69992] (1 PDB entry) |
Domain d1jadb_: 1jad B: [66462] CASP4 complexed with so4 |
PDB Entry: 1jad (more details), 2.4 Å
SCOPe Domain Sequences for d1jadb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jadb_ h.4.10.1 (B:) C-terminal domain of PLC-beta {Turkey (Meleagris gallopavo) [TaxId: 9103]} nmkevtqlpepqtaslaelqqmklflkllkkqekelkelerkgskrreellqkysvlfle pvyprgldsqvvelkerlemelihlgeeyhdgirrrkeqhateqtakitelarekqiael kalkessesnikdikkkleakrldriqvmmrstsdkaaqerlkkeinnshiqevvqtikl ltektaryqqkleekqaenlraiqekegqlqqeavaeyeeklktltvevqemvknymkev fp
Timeline for d1jadb_: