Lineage for d1j7eb3 (1j7e B:387-456)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 156418Fold a.126: Serum albumin-like [48551] (1 superfamily)
  4. 156419Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 156420Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 156492Protein Vitamin D binding protein [69111] (1 species)
  7. 156493Species Human (Homo sapiens) [TaxId:9606] [69112] (5 PDB entries)
  8. 156514Domain d1j7eb3: 1j7e B:387-456 [66408]

Details for d1j7eb3

PDB Entry: 1j7e (more details), 2.55 Å

PDB Description: a structural basis for the unique binding features of the human vitamin d-binding protein

SCOP Domain Sequences for d1j7eb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j7eb3 a.126.1.1 (B:387-456) Vitamin D binding protein {Human (Homo sapiens)}
gqelcadysentfteykkklaerlkaklpdatptelaklvnkrsdfasnccsinspplyc
dseidaelkn

SCOP Domain Coordinates for d1j7eb3:

Click to download the PDB-style file with coordinates for d1j7eb3.
(The format of our PDB-style files is described here.)

Timeline for d1j7eb3: