SCOPe 2.08: Domain d1j7eb3: 1j7e B:387-456

Lineage for d1j7eb3 (1j7e B:387-456)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Vitamin D binding protein [69111] (1 species)
   domain 3 lacks the last subdomain

7. Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries)

8. Domain d1j7eb3: 1j7e B:387-456 [66408]
   complexed with jy, ola
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1j7eb3

PDB Entry: 1j7e, 2.55 Å

PDB Description: a structural basis for the unique binding features of the human vitamin d-binding protein

PDB Compounds: (B:) vitamin D binding protein

SCOPe Domain Sequences for d1j7eb3:

Sequence; same for both SEQRES and ATOM records:

>d1j7eb3 a.126.1.1 (B:387-456) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
gqelcadysentfteykkklaerlkaklpdatptelaklvnkrsdfasnccsinspplyc
dseidaelkn

Timeline for d1j7eb3:

• d1j7eb3 first appeared in SCOP 1.59
  
• d1j7eb3 appears in SCOPe 2.07