| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) ![]() |
| Family a.126.1.1: Serum albumin-like [48553] (2 proteins) |
| Protein Vitamin D binding protein [69111] (1 species) domain 3 lacks the last subdomain |
| Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries) |
| Domain d1j7eb3: 1j7e B:387-456 [66408] complexed with jy, ola fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1j7e (more details), 2.55 Å
SCOPe Domain Sequences for d1j7eb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j7eb3 a.126.1.1 (B:387-456) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
gqelcadysentfteykkklaerlkaklpdatptelaklvnkrsdfasnccsinspplyc
dseidaelkn
Timeline for d1j7eb3: