| Class a: All alpha proteins [46456] (284 folds) | 
| Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains  | 
Superfamily a.126.1: Serum albumin-like [48552] (1 family) ![]()  | 
| Family a.126.1.1: Serum albumin-like [48553] (2 proteins) | 
| Protein Vitamin D binding protein [69111] (1 species) domain 3 lacks the last subdomain  | 
| Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries) | 
| Domain d1j7ea3: 1j7e A:387-457 [66405] complexed with jy, ola  | 
PDB Entry: 1j7e (more details), 2.55 Å
SCOPe Domain Sequences for d1j7ea3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j7ea3 a.126.1.1 (A:387-457) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
gqelcadysentfteykkklaerlkaklpdatptelaklvnkrsdfasnccsinspplyc
dseidaelkni
Timeline for d1j7ea3: