Lineage for d1j7ea3 (1j7e A:387-457)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 924235Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 924236Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 924237Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 924398Protein Vitamin D binding protein [69111] (1 species)
    domain 3 lacks the last subdomain
  7. 924399Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries)
  8. 924420Domain d1j7ea3: 1j7e A:387-457 [66405]
    complexed with jy, ola

Details for d1j7ea3

PDB Entry: 1j7e (more details), 2.55 Å

PDB Description: a structural basis for the unique binding features of the human vitamin d-binding protein
PDB Compounds: (A:) vitamin D binding protein

SCOPe Domain Sequences for d1j7ea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j7ea3 a.126.1.1 (A:387-457) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
gqelcadysentfteykkklaerlkaklpdatptelaklvnkrsdfasnccsinspplyc
dseidaelkni

SCOPe Domain Coordinates for d1j7ea3:

Click to download the PDB-style file with coordinates for d1j7ea3.
(The format of our PDB-style files is described here.)

Timeline for d1j7ea3: