Lineage for d1j7ea3 (1j7e A:387-457)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101110Fold a.126: Serum albumin-like [48551] (1 superfamily)
  4. 101111Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 101112Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 101184Protein Vitamin D binding protein [69111] (1 species)
  7. 101185Species Human (Homo sapiens) [TaxId:9606] [69112] (2 PDB entries)
  8. 101194Domain d1j7ea3: 1j7e A:387-457 [66405]

Details for d1j7ea3

PDB Entry: 1j7e (more details), 2.55 Å

PDB Description: a structural basis for the unique binding features of the human vitamin d-binding protein

SCOP Domain Sequences for d1j7ea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j7ea3 a.126.1.1 (A:387-457) Vitamin D binding protein {Human (Homo sapiens)}
gqelcadysentfteykkklaerlkaklpdatptelaklvnkrsdfasnccsinspplyc
dseidaelkni

SCOP Domain Coordinates for d1j7ea3:

Click to download the PDB-style file with coordinates for d1j7ea3.
(The format of our PDB-style files is described here.)

Timeline for d1j7ea3: