SCOPe 2.06: Domain d1j78a2: 1j78 A:199-386

Lineage for d1j78a2 (1j78 A:199-386)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Vitamin D binding protein [69111] (1 species)
   domain 3 lacks the last subdomain

7. Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries)

8. Domain d1j78a2: 1j78 A:199-386 [66398]
   complexed with ola, vdy

Details for d1j78a2

PDB Entry: 1j78, 2.31 Å

PDB Description: crystallographic analysis of the human vitamin d binding protein

PDB Compounds: (A:) vitamin D binding protein

SCOPe Domain Sequences for d1j78a2:

Sequence; same for both SEQRES and ATOM records:

>d1j78a2 a.126.1.1 (A:199-386) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
lsnrvcsqyaaygekksrlsnliklaqkvptadledvlplaeditnilskccesasedcm
akelpehtvklcdnlstknskfedccqektamdvfvctyfmpaaqlpelpdvelptnkdv
cdpgntkvmdkytfelsrrthlpevflskvleptlkslgeccdvedsttcfnakgpllkk
elssfidk

Timeline for d1j78a2:

• d1j78a2 first appeared in SCOP 1.59
  
• d1j78a2 appears in SCOPe 2.05
  
• d1j78a2 appears in SCOPe 2.07
  
• d1j78a2 appears in the current release, SCOPe 2.08