Lineage for d1j78a2 (1j78 A:199-386)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101110Fold a.126: Serum albumin-like [48551] (1 superfamily)
  4. 101111Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 101112Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 101184Protein Vitamin D binding protein [69111] (1 species)
  7. 101185Species Human (Homo sapiens) [TaxId:9606] [69112] (2 PDB entries)
  8. 101187Domain d1j78a2: 1j78 A:199-386 [66398]

Details for d1j78a2

PDB Entry: 1j78 (more details), 2.31 Å

PDB Description: crystallographic analysis of the human vitamin d binding protein

SCOP Domain Sequences for d1j78a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j78a2 a.126.1.1 (A:199-386) Vitamin D binding protein {Human (Homo sapiens)}
lsnrvcsqyaaygekksrlsnliklaqkvptadledvlplaeditnilskccesasedcm
akelpehtvklcdnlstknskfedccqektamdvfvctyfmpaaqlpelpdvelptnkdv
cdpgntkvmdkytfelsrrthlpevflskvleptlkslgeccdvedsttcfnakgpllkk
elssfidk

SCOP Domain Coordinates for d1j78a2:

Click to download the PDB-style file with coordinates for d1j78a2.
(The format of our PDB-style files is described here.)

Timeline for d1j78a2: