SCOP 1.59: Domain d1j78b2: 1j78 B:199-386

Lineage for d1j78b2 (1j78 B:199-386)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)

4. Superfamily a.126.1: Serum albumin-like [48552] (1 family)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Vitamin D binding protein [69111] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69112] (2 PDB entries)

8. Domain d1j78b2: 1j78 B:199-386 [66401]

Details for d1j78b2

PDB Entry: 1j78, 2.31 Å

PDB Description: crystallographic analysis of the human vitamin d binding protein

SCOP Domain Sequences for d1j78b2:

Sequence; same for both SEQRES and ATOM records:

>d1j78b2 a.126.1.1 (B:199-386) Vitamin D binding protein {Human (Homo sapiens)}
lsnrvcsqyaaygekksrlsnliklaqkvptadledvlplaeditnilskccesasedcm
akelpehtvklcdnlstknskfedccqektamdvfvctyfmpaaqlpelpdvelptnkdv
cdpgntkvmdkytfelsrrthlpevflskvleptlkslgeccdvedsttcfnakgpllkk
elssfidk

Timeline for d1j78b2:

• d1j78b2 is new in SCOP 1.59
  
• d1j78b2 appears in SCOP 1.61
  
• d1j78b2 appears in the current release, SCOPe 2.08