Lineage for d1j78a2 (1j78 A:199-386)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1098092Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 1098093Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 1098094Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 1098255Protein Vitamin D binding protein [69111] (1 species)
    domain 3 lacks the last subdomain
  7. 1098256Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries)
  8. 1098270Domain d1j78a2: 1j78 A:199-386 [66398]
    complexed with ola, vdy

Details for d1j78a2

PDB Entry: 1j78 (more details), 2.31 Å

PDB Description: crystallographic analysis of the human vitamin d binding protein
PDB Compounds: (A:) vitamin D binding protein

SCOPe Domain Sequences for d1j78a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j78a2 a.126.1.1 (A:199-386) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
lsnrvcsqyaaygekksrlsnliklaqkvptadledvlplaeditnilskccesasedcm
akelpehtvklcdnlstknskfedccqektamdvfvctyfmpaaqlpelpdvelptnkdv
cdpgntkvmdkytfelsrrthlpevflskvleptlkslgeccdvedsttcfnakgpllkk
elssfidk

SCOPe Domain Coordinates for d1j78a2:

Click to download the PDB-style file with coordinates for d1j78a2.
(The format of our PDB-style files is described here.)

Timeline for d1j78a2: