SCOP 1.63: Domain d1iswb1: 1isw B:804-936

Lineage for d1iswb1 (1isw B:804-936)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.42: beta-Trefoil [50352] (6 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (2 families)

5. Family b.42.2.1: Ricin B-like [50371] (2 proteins)

6. Protein Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) [50377] (2 species)

7. Species Streptomyces olivaceoviridis [TaxId:1921] [50378] (7 PDB entries)

8. Domain d1iswb1: 1isw B:804-936 [66347]
   Other proteins in same PDB: d1iswa2, d1iswb2
   complexed with xys

Details for d1iswb1

PDB Entry: 1isw, 2.1 Å

PDB Description: crystal structure of xylanase from streptomyces olivaceoviridis e-86 complexed with xylobiose

SCOP Domain Sequences for d1iswb1:

Sequence; same for both SEQRES and ATOM records:

>d1iswb1 b.42.2.1 (B:804-936) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces olivaceoviridis}
sstpppsgggqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygd
kcldaagtgngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqly
scsngsnqrwtrt

Timeline for d1iswb1:

• d1iswb1 first appeared in SCOP 1.59
  
• d1iswb1 appears in SCOP 1.61
  
• d1iswb1 appears in SCOP 1.65
  
• d1iswb1 appears in the current release, SCOPe 2.08