![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.205: GTP cyclohydrolase I feedback regulatory protein, GFRP [69760] (1 superfamily) beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta, antiparallel beta-sheet: order 342165 |
![]() | Superfamily d.205.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69761] (1 family) ![]() |
![]() | Family d.205.1.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69762] (1 protein) |
![]() | Protein GTP cyclohydrolase I feedback regulatory protein, GFRP [69763] (1 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [69764] (3 PDB entries) |
![]() | Domain d1is8o_: 1is8 O: [66335] Other proteins in same PDB: d1is8a_, d1is8b_, d1is8c_, d1is8d_, d1is8e_, d1is8f_, d1is8g_, d1is8h_, d1is8i_, d1is8j_ |
PDB Entry: 1is8 (more details), 2.7 Å
SCOP Domain Sequences for d1is8o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1is8o_ d.205.1.1 (O:) GTP cyclohydrolase I feedback regulatory protein, GFRP {Rat (Rattus norvegicus)} mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl ecrgfrvlsmtgvgqtlvwclhke
Timeline for d1is8o_: