Lineage for d1is7j_ (1is7 J:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 416305Fold d.96: T-fold [55619] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 416306Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 416307Family d.96.1.1: GTP cyclohydrolase I [55621] (1 protein)
  6. 416308Protein GTP cyclohydrolase I [55622] (3 species)
    beta-sheets of five subunits form a barrel, closed: n=20, S=20
  7. 416421Species Rat (Rattus norvegicus) [TaxId:10116] [69790] (2 PDB entries)
  8. 416441Domain d1is7j_: 1is7 J: [66310]
    Other proteins in same PDB: d1is7k_, d1is7l_, d1is7m_, d1is7n_, d1is7o_, d1is7p_, d1is7q_, d1is7r_, d1is7s_, d1is7t_
    complexed with k, phe

Details for d1is7j_

PDB Entry: 1is7 (more details), 2.8 Å

PDB Description: crystal structure of rat gtpchi/gfrp stimulatory complex

SCOP Domain Sequences for d1is7j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1is7j_ d.96.1.1 (J:) GTP cyclohydrolase I {Rat (Rattus norvegicus)}
rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgvqkmnsktvtstmlgvfre
dpktreefltlirs

SCOP Domain Coordinates for d1is7j_:

Click to download the PDB-style file with coordinates for d1is7j_.
(The format of our PDB-style files is described here.)

Timeline for d1is7j_: